PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.ERP3F
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 315aa    MW: 34397.2 Da    PI: 6.9064
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.ERP3FgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1062.1e-334296155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt++LHerFv+av+qLGG+ kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Araip.ERP3F 42 KPRLRWTQDLHERFVDAVTQLGGASKATPKAIMRTMNVKGLTLFHLKSHLQKYRL 96
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-323997IPR009057Homeodomain-like
PROSITE profilePS512949.5693999IPR017930Myb domain
TIGRFAMsTIGR015577.8E-244297IPR006447Myb domain, plants
SuperFamilySSF466891.29E-164298IPR009057Homeodomain-like
PfamPF002492.1E-74495IPR001005SANT/Myb domain
PfamPF143793.8E-15138184IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MYPRLIHPHE AGLVGQEDVQ VGGASNLTHK GDPCLVLTAD PKPRLRWTQD LHERFVDAVT  60
QLGGASKATP KAIMRTMNVK GLTLFHLKSH LQKYRLGKQS GKDMGEGCKD GLSGSYLESP  120
GTDNSSPKLP TSDTNEGFEI KEALRAQMEV QSKLHLQVEA EKHLQIRQDA EQRYMVMLER  180
ACKMLADQFI GATVIDTDNQ KFQGVGSKTP RGPMVDPLGF FSMPSTEVAG VNVPEEELPH  240
SLPPQRADCS TESCLTSHET TGGLILEGSP GEGKRRLLGM DSMAAPLIWT EAKMRTQAIN  300
VAQGNPHGIT RYAGM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016197621.10.0PREDICTED: myb family transcription factor APL-like isoform X1
RefseqXP_016197622.10.0PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK56e-48APL_ARATH; Myb family transcription factor APL
TrEMBLA0A0B2PYL10.0A0A0B2PYL1_GLYSO; Myb family transcription factor APL
TrEMBLC6T8560.0C6T856_SOYBN; Uncharacterized protein
STRINGGLYMA15G12930.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-64G2-like family protein